4o62/1/1:A/1:C

Sequences
>4o62-a1-m1-cA (length=56) [Search sequence]
ENMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNNCSISEED
>4o62-a1-m1-cC (length=56) [Search sequence]
ENMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNNCSISEED
Structure information
PDB ID 4o62 (database links: RCSB PDB PDBe PDBj PDBsum)
Title CW-type zinc finger of ZCWPW2 in complex with the amino terminus of histone H3
Assembly ID 1
Resolution 1.78Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 25
Sequence identity between the two chains 1.0
PubMed citation 26933034
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A C
UniProt accession Q504Y3 Q504Y3
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:4o62A BioLiP:4o62C
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4o62-a1-m1-cA_4o62-a1-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4o62-assembly1.cif.gz

[Back to Home]