4o62/1/1:C/1:B

Sequences

>4o62-a1-m1-cC (length=56) [Search sequence]

ENMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNNCSISEED

>4o62-a1-m1-cB (length=57) [Search sequence]

ENMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNNCSISEEDF

Structure information

PDB ID	4o62 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	CW-type zinc finger of ZCWPW2 in complex with the amino terminus of histone H3
Assembly ID	1
Resolution	1.78Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	36
Sequence identity between the two chains	1.0
PubMed citation	26933034

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	B
UniProt accession	Q504Y3	Q504Y3
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:4o62C	BioLiP:4o62B

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4o62-a1-m1-cC_4o62-a1-m1-cB.pdb.gz

Full biological assembly Download: 4o62-assembly1.cif.gz