4o9b/5/1:D/3:B

Sequences
>4o9b-a5-m1-cD (length=89) [Search sequence]
LEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQEAQRLKELREGT
ENERSRQKYAEEEMEQVREALRKAEKELE
>4o9b-a5-m3-cB (length=90) [Search sequence]
DLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQEAQRLKELREG
TENERSRQKYAEEEMEQVREALRKAEKELE
Structure information
PDB ID 4o9b (database links: RCSB PDB PDBe PDBj PDBsum)
Title The Structure of CC1-IH in human STIM1.
Assembly ID 5
Resolution 2.604Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 47
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 3
Chain ID D B
UniProt accession Q13586 Q13586
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4o9b-a5-m1-cD_4o9b-a5-m3-cB.pdb.gz
Full biological assembly
Download: 4o9b-assembly5.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 4o9b/5/1:A/1:D 4o9b/1/1:A/1:D
  • 4o9b/4/1:D/3:C 4o9b/3/1:A/2:B
    		•

    [Back to Home]