4ofi/4/1:H/1:G

Sequences
>4ofi-a4-m1-cH (length=105) [Search sequence]
GQHFAMEPQDQTAVVGSRVTLPCRVMEKVGALQWTKDDFGLGQHRNLSGFERYSMVGSDE
EGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVP
>4ofi-a4-m1-cG (length=106) [Search sequence]
GQHFAMEPQDQTAVVGSRVTLPCRVMEKVGALQWTKDDFGLGQHRNLSGFERYSMVGSDE
EGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPH
Structure information
PDB ID 4ofi (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Duf (Kirre) D1
Assembly ID 4
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 47
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID H G
UniProt accession Q9W4T9 Q9W4T9
Species 7227 (Drosophila melanogaster) 7227 (Drosophila melanogaster)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4ofi-a4-m1-cH_4ofi-a4-m1-cG.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4ofi-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4ofi/1/1:A/1:B 4ofi/2/1:D/1:C 4ofi/3/1:E/1:F

[Back to Home]