4oiz/1/1:A/1:B

Sequences
>4oiz-a1-m1-cA (length=107) [Search sequence]
MGDTLTAGQKLERGGSLQSGNGAYTLTLQDDGNLVLYARDKAVWSTGTNGQDVVRAEVQT
DGNFVLYTAEKPVWHTDTKGKKEVKLVLQDDRNLVLYAKDGPAWSLE
>4oiz-a1-m1-cB (length=107) [Search sequence]
MGDTLTAGQKLERGGSLQSGNGAYTLTLQDDGNLVLYARDKAVWSTGTNGQDVVRAEVQT
DGNFVLYTAEKPVWHTDTKGKKEVKLVLQDDRNLVLYAKDGPAWSLE
Structure information
PDB ID 4oiz (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure, interactions and evolutionary implications of a domain-swapped lectin dimer from Mycobacterium smegmatis
Assembly ID 1
Resolution 3.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 192
Sequence identity between the two chains 1.0
PubMed citation 24957055
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession A0QYH7 A0QYH7
Species 246196 (Mycolicibacterium smegmatis MC2 155) 246196 (Mycolicibacterium smegmatis MC2 155)
Function annotation BioLiP:4oizA BioLiP:4oizB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4oiz-a1-m1-cA_4oiz-a1-m1-cB.pdb.gz
Full biological assembly
Download: 4oiz-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4oit/1/1:A/1:B 4oit/2/1:C/1:D 4oiz/2/1:D/1:C 4oiz/3/1:E/2:E 4okc/1/1:B/1:A

[Back to Home]