4oln/1/1:B/1:A

Sequences
>4oln-a1-m1-cB (length=67) [Search sequence]
KRLCQVCGDHASGFHYGVWSCEGCKAFFKRSIQDYVCPATNNCTIDKHRRKSCQACRLRK
CLEVGMT
>4oln-a1-m1-cA (length=70) [Search sequence]
KPKRLCQVCGDHASGFHYGVWSCEGCKAFFKRSIQVDYVCPATNNCTIDKHRRKSCQACR
LRKCLEVGMT
Structure information
PDB ID 4oln (database links: RCSB PDB PDBe PDBj PDBsum)
Title Ancestral Steroid Receptor 1 in complex with estrogen response element DNA
Assembly ID 1
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 42
Sequence identity between the two chains 1.0
PubMed citation 25259920
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession
Species 32630 (synthetic construct) 32630 (synthetic construct)
Function annotation BioLiP:4olnB BioLiP:4olnA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4oln-a1-m1-cB_4oln-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4oln-assembly1.cif.gz

[Back to Home]