4olp/2/3:D/3:C

Sequences
>4olp-a2-m3-cD (length=80) [Search sequence]
KKRIINAPTLETLAMLKRRMPSESRNRIDAIGLIMLPVPDLYFYADQASKSAHVAVSEIF
TLAIFGEVAAVNEAMRIIED
>4olp-a2-m3-cC (length=87) [Search sequence]
KKRIINAPTLETLAMLKRRMPSESRNRLEMVRIDAIGLIMLPVPDLYFYADQASKSAHVA
VSEIFITTLAIFGEVAAVNEAMRIIED
Structure information
PDB ID 4olp (database links: RCSB PDB PDBe PDBj PDBsum)
Title Ligand-free structure of the GrpU microcompartment shell protein from Pectobacterium wasabiae
Assembly ID 2
Resolution 2.79Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 47
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 3 3
Chain ID D C
UniProt accession
Species 561231 (Pectobacterium parmentieri WPP163) 561231 (Pectobacterium parmentieri WPP163)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4olp-a2-m3-cD_4olp-a2-m3-cC.pdb.gz
Full biological assembly
Download: 4olp-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4olp/2/1:D/1:C 4olp/2/1:D/2:C 4olp/2/2:D/2:C 4olp/2/2:D/3:C 4olp/2/3:D/1:C

[Back to Home]