4om4/1/1:C/1:E

Sequences

>4om4-a1-m1-cC (length=60) [Search sequence]

LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

>4om4-a1-m1-cE (length=60) [Search sequence]

LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Structure information

PDB ID	4om4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of CTX A2 from Taiwan Cobra (Naja naja atra)
Assembly ID	1
Resolution	2.74Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	10
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	E
UniProt accession	P01442	P01442
Species	8656 (Naja atra)	8656 (Naja atra)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4om4-a1-m1-cC_4om4-a1-m1-cE.pdb.gz

Full biological assembly Download: 4om4-assembly1.cif.gz