4ova/1/1:C/1:D

Sequences

>4ova-a1-m1-cC (length=199) [Search sequence]

MEELVVEVRGSNGAFYKAFVKDVHEDSITVAFENNWQPDRQIPFHDVRFPPPVGYNKDIN
ESDEVEVYSRANEKEPCCWWLAKVRMIKGEFYVIEYAACDATYNEIVTIERLRSVNPNKP
ATKDTFHKIKLDVPEDLRQMCAKEAAHKDFKKAVGAFSVTYDPENYQLVILSINEVTSKR
AHMLIDMHFRSLRTKLSLI

>4ova-a1-m1-cD (length=200) [Search sequence]

Structure information

PDB ID	4ova (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of the two tandem Tudor domains and a new identified KH0 domain from human Fragile X Mental Retardation Protein
Assembly ID	1
Resolution	3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	32
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	Q06787	Q06787
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	4ova-a1-m1-cC_4ova-a1-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	4ova-assembly1.cif.gz