4owi/1/1:A/1:B

Sequences
>4owi-a1-m1-cA (length=33) [Search sequence]
GSMRMKQLEDKVGELLFSNYWLELEVARLKKLV
>4owi-a1-m1-cB (length=33) [Search sequence]
GSMRMKQLEDKVGELLFSNYWLELEVARLKKLV
Structure information
PDB ID 4owi (database links: RCSB PDB PDBe PDBj PDBsum)
Title peptide structure
Assembly ID 1
Resolution 1.202Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 47
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P03069 P03069
Species 32630 (synthetic construct) 32630 (synthetic construct)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4owi-a1-m1-cA_4owi-a1-m1-cB.pdb.gz
Full biological assembly
Download: 4owi-assembly1.cif.gz

[Back to Home]