4ox0/2/2:C/1:B

Sequences
>4ox0-a2-m2-cC (length=91) [Search sequence]
LAVELSSQQEYLKLKERYDALQRTQRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRT
QFMLDQLNDLQSKERMLTETNKTLRLRLADG
>4ox0-a2-m1-cB (length=95) [Search sequence]
PSREALAVELSSQQEYLKLKERYDALQRTQRNLLGEDLGPLSTKELESLERQLDSSLKQI
RALRTQFMLDQLNDLQSKERMLTETNKTLRLRLAD
Structure information
PDB ID 4ox0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the keratin-like domain from the MADS transcription factor Sepallata 3
Assembly ID 2
Resolution 2.49Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 90
Sequence identity between the two chains 0.989
Chain information
Chain 1 Chain 2
Model ID 2 1
Chain ID C B
UniProt accession O22456 O22456
Species 3702 (Arabidopsis thaliana) 3702 (Arabidopsis thaliana)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4ox0-a2-m2-cC_4ox0-a2-m1-cB.pdb.gz
Full biological assembly
Download: 4ox0-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4ox0/1/1:D/2:A 4ox0/1/2:D/1:A 4ox0/2/1:C/2:B
Other dimers with similar sequences but different poses
  • 4ox0/2/2:C/2:B 4ox0/1/1:D/1:A 4ox0/1/2:D/2:A 4ox0/2/1:C/1:B
  • [Back to Home]