4ox0/2/2:C/2:B

Sequences

>4ox0-a2-m2-cC (length=91) [Search sequence]

LAVELSSQQEYLKLKERYDALQRTQRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRT QFMLDQLNDLQSKERMLTETNKTLRLRLADG

>4ox0-a2-m2-cB (length=95) [Search sequence]

PSREALAVELSSQQEYLKLKERYDALQRTQRNLLGEDLGPLSTKELESLERQLDSSLKQI RALRTQFMLDQLNDLQSKERMLTETNKTLRLRLAD

Structure information

PDB ID	4ox0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the keratin-like domain from the MADS transcription factor Sepallata 3
Assembly ID	2
Resolution	2.49Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	43
Sequence identity between the two chains	0.989

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	C	B
UniProt accession	O22456	O22456
Species	3702 (Arabidopsis thaliana)	3702 (Arabidopsis thaliana)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4ox0-a2-m2-cC_4ox0-a2-m2-cB.pdb.gz

Full biological assembly Download: 4ox0-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	4ox0/1/1:D/1:A 4ox0/1/2:D/2:A 4ox0/2/1:C/1:B
Other dimers with similar sequences but different poses	4ox0/2/2:C/1:B 4ox0/1/1:D/2:A 4ox0/1/2:D/1:A 4ox0/2/1:C/2:B