4p2y/3/1:B/3:B

Sequences

>4p2y-a3-m1-cB (length=88) [Search sequence]

ACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMDDLD RNKDQEVNFQEYVAFLGALALIYNEALK

>4p2y-a3-m3-cB (length=88) [Search sequence]

ACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMDDLD RNKDQEVNFQEYVAFLGALALIYNEALK

Structure information

PDB ID	4p2y (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the human RAGE ectodomain (fragment VC1C2) in complex with mouse S100A6
Assembly ID	3
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	86
Sequence identity between the two chains	1.0
PubMed citation	27818100

Chain information

	Chain 1	Chain 2
Model ID	1	3
Chain ID	B	B
UniProt accession	P14069	P14069
Species	10090 (Mus musculus)	10090 (Mus musculus)
Function annotation	BioLiP:4p2yB	BioLiP:4p2yB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4p2y-a3-m1-cB_4p2y-a3-m3-cB.pdb.gz

Full biological assembly Download: 4p2y-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures	4p2y/2/1:B/3:B 4p2y/2/2:B/4:B
Other dimers with similar sequences but different poses	1jwd/1/1:A/1:B 2jtt/1/1:A/1:B 2m1k/1/1:B/1:D