4p2y/3/1:B/3:B

Sequences
>4p2y-a3-m1-cB (length=88) [Search sequence]
ACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMDDLD
RNKDQEVNFQEYVAFLGALALIYNEALK
>4p2y-a3-m3-cB (length=88) [Search sequence]
ACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMDDLD
RNKDQEVNFQEYVAFLGALALIYNEALK
Structure information
PDB ID 4p2y (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the human RAGE ectodomain (fragment VC1C2) in complex with mouse S100A6
Assembly ID 3
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 86
Sequence identity between the two chains 1.0
PubMed citation 27818100
Chain information
Chain 1 Chain 2
Model ID 1 3
Chain ID B B
UniProt accession P14069 P14069
Species 10090 (Mus musculus) 10090 (Mus musculus)
Function annotation BioLiP:4p2yB BioLiP:4p2yB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4p2y-a3-m1-cB_4p2y-a3-m3-cB.pdb.gz
Full biological assembly
Download: 4p2y-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4p2y/2/1:B/3:B 4p2y/2/2:B/4:B
Other dimers with similar sequences but different poses
  • 1jwd/1/1:A/1:B 2jtt/1/1:A/1:B 2m1k/1/1:B/1:D
  • [Back to Home]