4p39/7/1:B/3:C

Sequences
>4p39-a7-m1-cB (length=69) [Search sequence]
STLQKKIEEIAAKYKHSVVKKCCYDGARVNNDETCEQRAARISLGPRCIKAFTECCVVAS
QLRANISFK
>4p39-a7-m3-cC (length=69) [Search sequence]
TLQKKIEEIAAKYKHSVVKKCCYDGARVNNDETCEQRAARISLGPRCIKAFTECCVVASQ
LRANISFKR
Structure information
PDB ID 4p39 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the human C5aR antagonist C5a-A8
Assembly ID 7
Resolution 2.401Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 42
Sequence identity between the two chains 0.986
Chain information
Chain 1 Chain 2
Model ID 1 3
Chain ID B C
UniProt accession P01031 P01031
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4p39-a7-m1-cB_4p39-a7-m3-cC.pdb.gz
Full biological assembly
Download: 4p39-assembly7.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4p39/5/1:B/3:C 4p39/5/2:D/1:A 4p39/6/2:D/1:A
Other dimers with similar sequences but different poses
  • 3hqa/3/1:B/1:A 3hqb/3/1:B/1:A
  • [Back to Home]