4pcw/2/1:D/1:C

Sequences

>4pcw-a2-m1-cD (length=88) [Search sequence]

STLLENIFAIINLFKQYSKKDKNTDTLSKKELKELLEKEFRQILKNPDDPDMVDVFMDHL DIDHNKKIDFTEFLLMVFKLAQAYYEST

>4pcw-a2-m1-cC (length=91) [Search sequence]

STLLENIFAIINLFKQYSKKDKNTDTLSKKELKELLEKEFRQILKNPDDPDMVDVFMDHL DIDHNKKIDFTEFLLMVFKLAQAYYESTRKE

Structure information

PDB ID	4pcw (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of the N-terminal Domain of Human Profilaggrin at 2.2 A Resolution
Assembly ID	2
Resolution	2.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	76
Sequence identity between the two chains	1.0
PubMed citation	25760235

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	C
UniProt accession	P20930	P20930
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:4pcwD	BioLiP:4pcwC

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4pcw-a2-m1-cD_4pcw-a2-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 4pcw-assembly2.cif.gz

Similar dimers