4ppe/2/1:B/2:B

Sequences
>4ppe-a2-m1-cB (length=67) [Search sequence]
LRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHK
RYHPIYI
>4ppe-a2-m2-cB (length=67) [Search sequence]
LRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHK
RYHPIYI
Structure information
PDB ID 4ppe (database links: RCSB PDB PDBe PDBj PDBsum)
Title human RNF4 RING domain
Assembly ID 2
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 32
Sequence identity between the two chains 1.0
PubMed citation 24714598
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B B
UniProt accession P78317 P78317
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:4ppeB BioLiP:4ppeB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4ppe-a2-m1-cB_4ppe-a2-m2-cB.pdb.gz
Full biological assembly
Download: 4ppe-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 4ppe/2/2:A/2:B 2xeu/1/1:A/2:A 3ng2/1/1:A/1:B 4ppe/2/1:A/1:B
  • 4ppe/2/1:A/2:B 4ppe/1/1:A/2:B 4ppe/2/2:A/1:B
  • [Back to Home]