4pwa/2/3:B/3:D

Sequences

>4pwa-a2-m3-cB (length=86) [Search sequence]

EDKLALGREIFLERSEPQCALCHTLADAEAVGEVGPNLDELKPDAERVNTAVTNGIGPMP ANEILTDEEIEAVALYVSTVAGKAKN

>4pwa-a2-m3-cD (length=87) [Search sequence]

EEDKLALGREIFLERSEPQCALCHTLADAEAVGEVGPNLDELKPDAERVNTAVTNGIGPM PANEILTDEEIEAVALYVSTVAGKAKN

Structure information

PDB ID	4pwa (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the c-type cytochrome SorU from Sinorhizobium meliloti
Assembly ID	2
Resolution	2.19Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	40
Sequence identity between the two chains	1.0
PubMed citation	26687009

Chain information

	Chain 1	Chain 2
Model ID	3	3
Chain ID	B	D
UniProt accession	Q92M25	Q92M25
Species	266834 (Sinorhizobium meliloti 1021)	266834 (Sinorhizobium meliloti 1021)
Function annotation	BioLiP:4pwaB	BioLiP:4pwaD

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4pwa-a2-m3-cB_4pwa-a2-m3-cD.pdb.gz

Full biological assembly Download: 4pwa-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4pwa/2/1:B/1:D 4pwa/2/1:B/3:D 4pwa/2/3:B/1:D