4pzj/1/1:A/2:A

Sequences
>4pzj-a1-m1-cA (length=67) [Search sequence]
LDFRVETFLTVRTNYTRAAEELNITQPAVSQHIAHLERDYGVPLFAYRNKKLQLTDAGAL
LRDALST
>4pzj-a1-m2-cA (length=67) [Search sequence]
LDFRVETFLTVRTNYTRAAEELNITQPAVSQHIAHLERDYGVPLFAYRNKKLQLTDAGAL
LRDALST
Structure information
PDB ID 4pzj (database links: RCSB PDB PDBe PDBj PDBsum)
Title 1.60 Angstrom resolution crystal structure of a transcriptional regulator of the LysR family from Eggerthella lenta DSM 2243
Assembly ID 1
Resolution 1.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 39
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession C8WJY2 C8WJY2
Species 479437 (Eggerthella lenta DSM 2243) 479437 (Eggerthella lenta DSM 2243)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4pzj-a1-m1-cA_4pzj-a1-m2-cA.pdb.gz
Full biological assembly
Download: 4pzj-assembly1.cif.gz

[Back to Home]