4q1r/1/1:A/1:B

Sequences

>4q1r-a1-m1-cA (length=130) [Search sequence]

CGLVASNLNLKPGELRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNS KDGGAWGTEQREAVFPFQPGSVAEVITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAAD GDFKIKVAFD

>4q1r-a1-m1-cB (length=130) [Search sequence]

CGLVASNLNLKPGELRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNS KDGGAWGTEQREAVFPFQPGSVAEVITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAAD GDFKIKVAFD

Structure information

PDB ID	4q1r (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Galectin-1 in Complex with Ligand AN027
Assembly ID	1
Resolution	1.47Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	36
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P09382	P09382
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:4q1rA	BioLiP:4q1rB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4q1r-a1-m1-cA_4q1r-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 4q1r-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1gzw/1/1:A/1:B 1w6m/1/1:A/1:B 1w6n/1/1:A/1:B 1w6o/1/1:A/1:B 1w6p/1/1:A/1:B 1w6q/1/1:A/1:B 2km2/1/1:A/1:B 2zkn/1/1:A/1:B 3oy8/1/1:A/1:B 3oyw/1/1:A/1:B 3t2t/1/1:A/1:B 3w58/1/1:A/1:B 3w58/2/1:C/1:D 3w59/1/1:A/1:B 3w59/2/1:D/1:C 4q1p/1/1:A/1:B 4q26/1/1:A/1:B 4q26/2/1:G/1:H 4q27/1/1:A/1:B 4q2f/1/1:A/1:B 4xbl/1/1:A/1:B 4y1u/1/1:A/1:B 4y1v/1/1:A/1:B 4y1x/1/1:A/1:B 4y1y/1/1:A/1:B 4y1z/1/1:A/1:B 4y20/1/1:B/1:A 4y22/1/1:A/1:B 4y24/1/1:A/1:B 5mwt/1/1:A/1:B 5mwx/1/1:A/1:B 6f83/1/1:A/1:B 7lta/1/1:A/1:B 7nml/1/1:A/1:B