4q37/4/1:D/1:F

Sequences

>4q37-a4-m1-cD (length=120) [Search sequence]

MYILFREMKNNWYSLAALLSTIYSRHLDVEARPVKFEEIKKFPPEKTIVAYSFMSFDLDT VREEVKTLKERGYTLIAGGPHVTADPEGCLRMGFDHVFTGDGEENILKFLMGERKKIFDG

>4q37-a4-m1-cF (length=120) [Search sequence]

MYILFREMKNNWYSLAALLSTIYSRHLDVEARPVKFEEIKKFPPEKTIVAYSFMSFDLDT VREEVKTLKERGYTLIAGGPHVTADPEGCLRMGFDHVFTGDGEENILKFLMGERKKIFDG

Structure information

PDB ID	4q37 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the hypothetical protein TM0182 Thermotoga maritima, N-terminal domain.
Assembly ID	4
Resolution	3.19Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	136
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	F
UniProt accession	Q9WY26	Q9WY26
Species	243274 (Thermotoga maritima MSB8)	243274 (Thermotoga maritima MSB8)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4q37-a4-m1-cD_4q37-a4-m1-cF.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 4q37-assembly4.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4q37/1/1:E/1:A 4q37/2/1:B/2:B 4q37/3/1:C/3:C