4qf2/2/1:B/1:D

Sequences
>4qf2-a2-m1-cB (length=51) [Search sequence]
KVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQ
>4qf2-a2-m1-cD (length=53) [Search sequence]
KVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV
Structure information
PDB ID 4qf2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of human BAZ2A PHD zinc finger in the free form
Assembly ID 2
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 54
Sequence identity between the two chains 1.0
PubMed citation 25533489
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B D
UniProt accession Q9UIF9 Q9UIF9
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:4qf2B BioLiP:4qf2D
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4qf2-a2-m1-cB_4qf2-a2-m1-cD.pdb.gz
Full biological assembly
Download: 4qf2-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4qf2/1/1:C/1:A 5t8r/5/1:C/1:A 5t8r/6/1:B/1:D

[Back to Home]