4qhh/1/3:A/4:A

Sequences
>4qhh-a1-m3-cA (length=108) [Search sequence]
KDRKILNEILSNTINELNLNDKKANIKIKIKPLKRKIASISLTNKTIYINKNILPYLSDE
EIRFILAHELLHLKYGKYHINEFEEELLFLFPNKEAILINLINKLHQK
>4qhh-a1-m4-cA (length=108) [Search sequence]
KDRKILNEILSNTINELNLNDKKANIKIKIKPLKRKIASISLTNKTIYINKNILPYLSDE
EIRFILAHELLHLKYGKYHINEFEEELLFLFPNKEAILINLINKLHQK
Structure information
PDB ID 4qhh (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Methanocaldococcus jannaschii tetrameric selecase
Assembly ID 1
Resolution 3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 53
Sequence identity between the two chains 1.0
PubMed citation 25159620
Chain information
Chain 1 Chain 2
Model ID 3 4
Chain ID A A
UniProt accession Q58610 Q58610
Species 243232 (Methanocaldococcus jannaschii DSM 2661) 243232 (Methanocaldococcus jannaschii DSM 2661)
Function annotation BioLiP:4qhhA BioLiP:4qhhA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4qhh-a1-m3-cA_4qhh-a1-m4-cA.pdb.gz
Full biological assembly
Download: 4qhh-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 4qhh/1/2:A/4:A 4qhh/1/1:A/3:A
  • 4qhh/1/1:A/4:A 4qhh/1/2:A/3:A
  • 4qhi/2/1:C/1:D 4qhi/1/1:A/1:B
  • [Back to Home]