4qhi/2/1:C/1:D

Sequences
>4qhi-a2-m1-cC (length=106) [Search sequence]
RKILNEILSNTINELNLNDKKANIKIKIKPLKWKIASISLTNKTIYINKNILPYLSDEEI
RFILAHELLHLKYGKYHINEFEEELLFLFPNKEAILINLINKLHQK
>4qhi-a2-m1-cD (length=107) [Search sequence]
DRKILNEILSNTINELNLNDKKANIKIKIKPLKWKIASISLTNKTIYINKNILPYLSDEE
IRFILAHELLHLKYGKYHINEFEEELLFLFPNKEAILINLINKLHQK
Structure information
PDB ID 4qhi (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Methanocaldococcus jannaschii selecase mutant R36W
Assembly ID 2
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 49
Sequence identity between the two chains 1.0
PubMed citation 25159620
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession Q58610 Q58610
Species 243232 (Methanocaldococcus jannaschii DSM 2661) 243232 (Methanocaldococcus jannaschii DSM 2661)
Function annotation BioLiP:4qhiC BioLiP:4qhiD
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4qhi-a2-m1-cC_4qhi-a2-m1-cD.pdb.gz
Full biological assembly
Download: 4qhi-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 4qhh/1/3:A/4:A 4qhh/1/1:A/2:A
  • 4qhh/1/2:A/4:A 4qhh/1/1:A/3:A
  • 4qhh/1/1:A/4:A 4qhh/1/2:A/3:A
  • [Back to Home]