4qic/1/1:B/1:D

Sequences
>4qic-a1-m1-cB (length=51) [Search sequence]
NHFTFGDDLLGVNSEIARKLRQFYLEIQEEALPARLLELLERLEQAERFGL
>4qic-a1-m1-cD (length=54) [Search sequence]
NHFTFGDDLLGVNSEIARKLRQFYLEIQEEALPARLLELLERLEQAERFGLNNA
Structure information
PDB ID 4qic (database links: RCSB PDB PDBe PDBj PDBsum)
Title Co-Crystal Structure of Anti-anti-sigma factor PhyR complexed with Anti-sigma factor NepR from Bartonella quintana
Assembly ID 1
Resolution 2.05Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 26
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B D
UniProt accession A0A0H3LV19 A0A0H3LV19
Species 283165 (Bartonella quintana str. Toulouse) 283165 (Bartonella quintana str. Toulouse)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4qic-a1-m1-cB_4qic-a1-m1-cD.pdb.gz
Full biological assembly
Download: 4qic-assembly1.cif.gz

[Back to Home]