4qpo/1/1:D/1:A

Sequences
>4qpo-a1-m1-cD (length=52) [Search sequence]
AKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHEAQ
>4qpo-a1-m1-cA (length=53) [Search sequence]
AKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHEAQM
Structure information
PDB ID 4qpo (database links: RCSB PDB PDBe PDBj PDBsum)
Title Mechanistic basis of plasmid-specific DNA binding of the F plasmid regulatory protein, TraM
Assembly ID 1
Resolution 1.999Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 15
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D A
UniProt accession P10026 P10026
Species 83333 (Escherichia coli K-12) 83333 (Escherichia coli K-12)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4qpo-a1-m1-cD_4qpo-a1-m1-cA.pdb.gz
Full biological assembly
Download: 4qpo-assembly1.cif.gz

[Back to Home]