4qpq/1/1:G/1:F

Sequences

>4qpq-a1-m1-cG (length=50) [Search sequence]

AKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHE

>4qpq-a1-m1-cF (length=52) [Search sequence]

AKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHEAQ

Structure information

PDB ID	4qpq (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Mechanistic basis of plasmid-specific DNA binding of the F plasmid regulatory protein, TraM
Assembly ID	1
Resolution	3.106Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	99
Sequence identity between the two chains	1.0
PubMed citation	25284757

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	G	F
UniProt accession	P10026	P10026
Species	83333 (Escherichia coli K-12)	83333 (Escherichia coli K-12)
Function annotation	BioLiP:4qpqG	BioLiP:4qpqF

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4qpq-a1-m1-cG_4qpq-a1-m1-cF.pdb.gz

Full biological assembly Download: 4qpq-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4qpo/1/1:A/1:C 4qpo/1/1:B/1:D 4qpq/1/1:A/1:D 4qpq/1/1:B/1:C 4qpq/1/1:E/1:H