4qyi/2/1:B/1:C

Sequences
>4qyi-a2-m1-cB (length=170) [Search sequence]
IEIKDTLISEEQLQEKVKELALQIERDFEGEEIVVIAVLKGSFVFAADLIRHIKNDVTID
FISASSYGNQTETTGKVKLLKDIDVNITGKNVIVVEDIIDSGLTLHFLKDHFFMHKPKAL
KFCTLLDKPERRKVDLTAEYVGFQIPDEFIVGYGIDAEKYRNLPFIASVV
>4qyi-a2-m1-cC (length=170) [Search sequence]
IEIKDTLISEEQLQEKVKELALQIERDFEGEEIVVIAVLKGSFVFAADLIRHIKNDVTID
FISASSYGNQTETTGKVKLLKDIDVNITGKNVIVVEDIIDSGLTLHFLKDHFFMHKPKAL
KFCTLLDKPERRKVDLTAEYVGFQIPDEFIVGYGIDAEKYRNLPFIASVV
Structure information
PDB ID 4qyi (database links: RCSB PDB PDBe PDBj PDBsum)
Title 1.95 Angstrom resolution crystal structure of a hypoxanthine-guanine phosphoribosyltransferase (hpt-2) from Bacillus anthracis str. 'Ames Ancestor' with HEPES molecule in the active site
Assembly ID 2
Resolution 1.95Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 65
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession A0A6L8PVA4 A0A6L8PVA4
Species 1392 (Bacillus anthracis) 1392 (Bacillus anthracis)
Function annotation BioLiP:4qyiB BioLiP:4qyiC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4qyi-a2-m1-cB_4qyi-a2-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4qyi-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3o7m/1/1:C/1:B 3o7m/1/1:D/1:A 4qyi/1/1:D/1:A 4qyi/3/1:E/2:E
Other dimers with similar sequences but different poses
  • 3o7m/1/1:C/1:D 3o7m/1/1:A/1:B
    		•

    [Back to Home]