4r2y/6/3:D/3:C

Sequences
>4r2y-a6-m3-cD (length=62) [Search sequence]
DENCGICRMAFNGCCPDCKDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKF
KE
>4r2y-a6-m3-cC (length=65) [Search sequence]
DENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQE
WKFKE
Structure information
PDB ID 4r2y (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of APC11 RING domain
Assembly ID 6
Resolution 1.755Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 79
Sequence identity between the two chains 1.0
PubMed citation 25306923
Chain information
Chain 1 Chain 2
Model ID 3 3
Chain ID D C
UniProt accession Q9NYG5 Q9NYG5
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:4r2yD BioLiP:4r2yC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4r2y-a6-m3-cD_4r2y-a6-m3-cC.pdb.gz
Full biological assembly
Download: 4r2y-assembly6.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4r2y/5/1:B/1:A 4r2y/5/2:B/2:A 4r2y/6/1:D/1:C
Other dimers with similar sequences but different poses
  • 4r2y/6/1:C/3:C 4r2y/5/1:A/2:A
  • 4r2y/6/3:D/1:C 4r2y/5/1:B/2:A 4r2y/5/2:B/1:A 4r2y/6/1:D/3:C
    		•

    [Back to Home]