4r4e/1/1:A/1:B

Sequences
>4r4e-a1-m1-cA (length=83) [Search sequence]
MSDNIRRSMPLFPIGIVMQLTELSARQIRYYEENGLIFPARTEGNRRLFSFHDVDKLLEI
KHLIEQGVNMAGIKQILAKAEAE
>4r4e-a1-m1-cB (length=84) [Search sequence]
MSDNIRRSMPLFPIGIVMQLTELSARQIRYYEENGLIFPARTEGNRRLFSFHDVDKLLEI
KHLIEQGVNMAGIKQILAKAEAEP
Structure information
PDB ID 4r4e (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of GlnR-DNA complex
Assembly ID 1
Resolution 2.57Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 41
Sequence identity between the two chains 1.0
PubMed citation 25691471
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P37582 P37582
Species 224308 (Bacillus subtilis subsp. subtilis str. 168) 224308 (Bacillus subtilis subsp. subtilis str. 168)
Function annotation BioLiP:4r4eB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4r4e-a1-m1-cA_4r4e-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4r4e-assembly1.cif.gz

[Back to Home]