4r4e/1/1:A/1:B

Sequences

>4r4e-a1-m1-cA (length=83) [Search sequence]

MSDNIRRSMPLFPIGIVMQLTELSARQIRYYEENGLIFPARTEGNRRLFSFHDVDKLLEI KHLIEQGVNMAGIKQILAKAEAE

>4r4e-a1-m1-cB (length=84) [Search sequence]

MSDNIRRSMPLFPIGIVMQLTELSARQIRYYEENGLIFPARTEGNRRLFSFHDVDKLLEI KHLIEQGVNMAGIKQILAKAEAEP

Structure information

PDB ID	4r4e (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of GlnR-DNA complex
Assembly ID	1
Resolution	2.57Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	41
Sequence identity between the two chains	1.0
PubMed citation	25691471

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P37582	P37582
Species	224308 (Bacillus subtilis subsp. subtilis str. 168)	224308 (Bacillus subtilis subsp. subtilis str. 168)
Function annotation	BioLiP:4r4eB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4r4e-a1-m1-cA_4r4e-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 4r4e-assembly1.cif.gz