4r9w/1/1:A/2:B

Sequences
>4r9w-a1-m1-cA (length=62) [Search sequence]
LQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKL
LE
>4r9w-a1-m2-cB (length=64) [Search sequence]
DLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKK
LLES
Structure information
PDB ID 4r9w (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of platelet factor 4 complexed with fondaparinux
Assembly ID 1
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 16
Sequence identity between the two chains 1.0
PubMed citation 26391892
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A B
UniProt accession P02776 P02776
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:4r9wB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4r9w-a1-m1-cA_4r9w-a1-m2-cB.pdb.gz
Full biological assembly
Download: 4r9w-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1f9q/1/1:B/1:D 1f9q/1/1:C/1:A 1f9r/1/1:A/1:C 1f9r/1/1:B/1:D 1f9s/1/1:B/1:D 1f9s/1/1:C/1:A 1rhp/1/1:A/1:D 1rhp/1/1:B/1:C 4hsv/1/1:B/1:D 4hsv/1/1:C/1:A 4r9w/1/2:A/1:B
Other dimers with similar sequences but different poses
  • 4r9y/1/1:B/1:D 1f9q/1/1:A/1:D 1f9r/1/1:A/1:D 1f9s/1/1:D/1:A 1rhp/1/1:B/1:D 4r9w/1/1:B/2:B 4r9y/2/1:A/1:C
  • 4r9w/1/2:A/2:B 1f9q/1/1:B/1:A 1f9q/1/1:C/1:D 1f9r/1/1:B/1:A 1f9r/1/1:C/1:D 1f9s/1/1:B/1:A 1f9s/1/1:C/1:D 1pfm/1/1:A/1:B 1pfm/1/1:C/1:D 1pfn/1/1:A/1:B 1pfn/1/1:C/1:D 1rhp/1/1:A/1:B 1rhp/1/1:C/1:D 4r9w/1/1:A/1:B
  • 1f9q/1/1:B/1:C 1f9r/1/1:B/1:C 1f9s/1/1:B/1:C 1rhp/1/1:A/1:C 4hsv/1/1:B/1:C 4r9w/1/1:A/2:A
  • 1pfn/1/1:B/1:D 1pfm/1/1:A/1:C 1pfm/1/1:B/1:D 1pfn/1/1:A/1:C
  • 1pfn/1/1:B/1:C 1pfm/1/1:A/1:D 1pfm/1/1:B/1:C 1pfn/1/1:A/1:D
  • 4hsv/1/1:C/1:D 4hsv/1/1:B/1:A
  • [Back to Home]