4r9y/1/1:B/1:D

Sequences

>4r9y-a1-m1-cB (length=65) [Search sequence]

GDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIK KLLES

>4r9y-a1-m1-cD (length=65) [Search sequence]

GDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIK KLLES

Structure information

PDB ID	4r9y (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of KKOFab in complex with platelet factor 4
Assembly ID	1
Resolution	4.11Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	43
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	D
UniProt accession	P02776	P02776
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4r9y-a1-m1-cB_4r9y-a1-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 4r9y-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1f9q/1/1:A/1:D 1f9r/1/1:A/1:D 1f9s/1/1:D/1:A 1rhp/1/1:B/1:D 4r9w/1/1:B/2:B 4r9y/2/1:A/1:C

Other dimers with similar sequences but different poses

4r9w/1/2:A/2:B 1f9q/1/1:B/1:A 1f9q/1/1:C/1:D 1f9r/1/1:B/1:A 1f9r/1/1:C/1:D 1f9s/1/1:B/1:A 1f9s/1/1:C/1:D 1pfm/1/1:A/1:B 1pfm/1/1:C/1:D 1pfn/1/1:A/1:B 1pfn/1/1:C/1:D 1rhp/1/1:A/1:B 1rhp/1/1:C/1:D 4r9w/1/1:A/1:B 4r9w/1/1:A/2:B 1f9q/1/1:B/1:D 1f9q/1/1:C/1:A 1f9r/1/1:A/1:C 1f9r/1/1:B/1:D 1f9s/1/1:B/1:D 1f9s/1/1:C/1:A 1rhp/1/1:A/1:D 1rhp/1/1:B/1:C 4hsv/1/1:B/1:D 4hsv/1/1:C/1:A 4r9w/1/2:A/1:B 1f9q/1/1:B/1:C 1f9r/1/1:B/1:C 1f9s/1/1:B/1:C 1rhp/1/1:A/1:C 4hsv/1/1:B/1:C 4r9w/1/1:A/2:A 1pfn/1/1:B/1:D 1pfm/1/1:A/1:C 1pfm/1/1:B/1:D 1pfn/1/1:A/1:C 1pfn/1/1:B/1:C 1pfm/1/1:A/1:D 1pfm/1/1:B/1:C 1pfn/1/1:A/1:D 4hsv/1/1:C/1:D 4hsv/1/1:B/1:A