4rle/1/2:A/3:A

Sequences

>4rle-a1-m2-cA (length=116) [Search sequence]

HHHHHGSMKLIVAVVQDQDSNRLLKTLTDHNFRVTKLATTGGFLKSGNTTFMIGVEDIRV NKALSLIKENGQKRDQMIAPVSPMGGNADSYVPYPVEVEVGGATVFVLPVDEFHQF

>4rle-a1-m3-cA (length=116) [Search sequence]

HHHHHGSMKLIVAVVQDQDSNRLLKTLTDHNFRVTKLATTGGFLKSGNTTFMIGVEDIRV NKALSLIKENGQKRDQMIAPVSPMGGNADSYVPYPVEVEVGGATVFVLPVDEFHQF

Structure information

PDB ID	4rle (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the c-di-AMP binding PII-like protein DarA
Assembly ID	1
Resolution	1.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	76
Sequence identity between the two chains	1.0
PubMed citation	25433025

Chain information

	Chain 1	Chain 2
Model ID	2	3
Chain ID	A	A
UniProt accession	P37538	P37538
Species	224308 (Bacillus subtilis subsp. subtilis str. 168)	224308 (Bacillus subtilis subsp. subtilis str. 168)
Function annotation	BioLiP:4rleA	BioLiP:4rleA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4rle-a1-m2-cA_4rle-a1-m3-cA.pdb.gz

Full biological assembly Download: 4rle-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4rle/1/1:A/2:A 4rle/1/1:A/3:A