4rp3/1/1:B/1:A

Sequences
>4rp3-a1-m1-cB (length=90) [Search sequence]
QEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALLDIQEFYELTLLDDSK
SIQQKTAETLQIATKWEKDGQAVKIADFIK
>4rp3-a1-m1-cA (length=91) [Search sequence]
KQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALLDIQEFYELTLLDDS
KSIQQKTAETLQIATKWEKDGQAVKIADFIK
Structure information
PDB ID 4rp3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the L27 Domain of Discs Large 1 (target ID NYSGRC-010766) from Drosophila melanogaster bound to a potassium ion (space group P212121)
Assembly ID 1
Resolution 1.36Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 149
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession P31007 P31007
Species 7227 (Drosophila melanogaster) 7227 (Drosophila melanogaster)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4rp3-a1-m1-cB_4rp3-a1-m1-cA.pdb.gz
Full biological assembly
Download: 4rp3-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4rp4/1/1:A/1:B 4rp5/1/1:B/1:A

[Back to Home]