4rs7/2/1:A/1:B

Sequences
>4rs7-a2-m1-cA (length=84) [Search sequence]
ADLESLYRAPSIKKLVDEGKLTEKDAEKVYEIWRNEAIYKQASLLWYNTVDLLLKRIGLS
EKEREEIFYEVRPYFRLFSREEVF
>4rs7-a2-m1-cB (length=85) [Search sequence]
ADLESLYRAPSIKKLVDEGKLTEKDAEKVYEIWRNEAIYKQASLLWYNTVDLLLKRIGLS
EKEREEIFYEVRPYFRLFSREEVFP
Structure information
PDB ID 4rs7 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of pNOB8 ParB-C
Assembly ID 2
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 99
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession O93707 O93707
Species 84600 (Sulfolobus sp. NOB8H2) 84600 (Sulfolobus sp. NOB8H2)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4rs7-a2-m1-cA_4rs7-a2-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4rs7-assembly2.cif.gz
Similar dimers

[Back to Home]