4rt0/2/1:B/1:C

Sequences

>4rt0-a2-m1-cB (length=106) [Search sequence]

AQRQFARVKLPARIRYIGANREGVDARLLDLSAGGFAFTASGAPIQPGDLYKGKLFQVDS ISFSLEVEFQVRSVDPASRRVGCEFQNLKPREVAALRYLITSYLAG

>4rt0-a2-m1-cC (length=106) [Search sequence]

QRQFARVKLPARIRYIGANREGVDARLLDLSAGGFAFTASGAPIQPGDLYKGKLFQVDSI SFSLEVEFQVRSVDPASRRVGCEFQNLKPREVAALRYLITSYLAGE

Structure information

PDB ID	4rt0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of the Alg44 PilZ domain from Pseudomonas aeruginosa PAO1 in complex with c-di-GMP
Assembly ID	2
Resolution	1.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	60
Sequence identity between the two chains	0.991
PubMed citation	25817996

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	Q9HY69	Q9HY69
Species	208964 (Pseudomonas aeruginosa PAO1)	208964 (Pseudomonas aeruginosa PAO1)
Function annotation	BioLiP:4rt0B	BioLiP:4rt0C

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4rt0-a2-m1-cB_4rt0-a2-m1-cC.pdb.gz

Full biological assembly Download: 4rt0-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4rt0/1/1:A/2:A 4rt1/1/1:A/2:A 4rt1/2/1:B/1:C 4xrn/1/1:A/1:C 4xrn/2/1:B/1:D