4s04/2/1:E/1:F

Sequences

>4s04-a2-m1-cE (length=219) [Search sequence]

MKILVIEDDALLLQGLILAMQSEGYVCDGVSTAHEAALSLASNHYSLIVLDLGLPDEDGL
HFLSRMRREKMTQPVLILTARDTLEDRISGLDTGADDYLVKPFALEELNARIRALLRRHN
NQGDNEISVGNLRLNVTRRLVWLGETALDLTPKEYALLSRLMMKAGSPVHREILYNDIYS
GDNEPATNTLEVHIHNLREKIGKSRIRTVRGFGYMLANN

>4s04-a2-m1-cF (length=219) [Search sequence]

Structure information

PDB ID	4s04 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Klebsiella pneumoniae PmrA in complex with PmrA box DNA
Assembly ID	2
Resolution	3.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	79
Sequence identity between the two chains	1.0
PubMed citation	26564787

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	F
UniProt accession	A0A0R4I965	A0A0R4I965
Species	1380908 (Klebsiella pneumoniae JM45)	1380908 (Klebsiella pneumoniae JM45)
Function annotation	BioLiP:4s04E	BioLiP:4s04F

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	4s04-a2-m1-cE_4s04-a2-m1-cF.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	4s04-assembly2.cif.gz