4tjx/1/1:B/1:A

Sequences
>4tjx-a1-m1-cB (length=3) [Search sequence]
ADS
>4tjx-a1-m1-cA (length=153) [Search sequence]
VEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDFDISFKS
KPGRLPTFVLIDRGDCYFTLKAWIAQQAGAAAILVADSKAEPLITMDTPDYLQNITIPSA
LITKTLGDSIKSALSGGDMVNMKLDWTESVPHP
Structure information
PDB ID 4tjx (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of protease-associated domain of Arabidopsis VSR1 in complex with aleurain peptide
Assembly ID 1
Resolution 1.902Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 18
Sequence identity between the two chains 1.0
PubMed citation 25271241
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession P93026
Species 4513 (Hordeum vulgare) 3702 (Arabidopsis thaliana)
Function annotation BioLiP:4tjxA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4tjx-a1-m1-cB_4tjx-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4tjx-assembly1.cif.gz

[Back to Home]