4tr9/1/1:A/1:D

Sequences

>4tr9-a1-m1-cA (length=347) [Search sequence]

EYMNAPKKLPADVAEELATTAQKLVQAGKGILAADESTQTIKKRFDNIKLENTIENRASY
RDLLFGTKGLGKFISGAILFEETLFQKNEAGVPMVNLLHNENIIPGIKVDKGLVNIPCTD
EEKSTQGLDGLAERCKEYYKAGARFAKWRTVLVIDTAKGKPTDLSIHETAWGLARYASIC
QQNRLVPIVEPEILADGPHSIEVCAVVTQKVLSCVFKALQENGVLLEGALLKPNMVTAGY
ECTAKTTTQDVGFLTVRTLRRTVPPALPGVVFLSGGQSEEEASVNLNSINALGPHPWALT
FSYGRALQASVLNTWQGKKENVAKAREVLLQRAEANSLATYGKYKGG

>4tr9-a1-m1-cD (length=347) [Search sequence]

Structure information

PDB ID	4tr9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Ternary co-crystal structure of fructose-bisphosphate aldolase from Plasmodium falciparum in complex with TRAP and a small molecule inhibitor
Assembly ID	1
Resolution	2.111Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	74
Sequence identity between the two chains	1.0
PubMed citation	26289816

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	D
UniProt accession	Q7KQL9	Q7KQL9
Species	36329 (Plasmodium falciparum 3D7)	36329 (Plasmodium falciparum 3D7)
Function annotation	BioLiP:4tr9A	BioLiP:4tr9D

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	4tr9-a1-m1-cA_4tr9-a1-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	4tr9-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1a5c/1/1:A/2:B 1a5c/1/1:B/2:A 2eph/1/1:B/1:C 2eph/1/1:D/1:A 2pc4/1/1:B/1:C 2pc4/1/1:D/1:A 4tr9/1/1:B/1:C
Other dimers with similar sequences but different poses	4tr9/1/1:C/1:D 1a5c/1/1:A/1:B 1a5c/1/2:A/2:B 2eph/1/1:B/1:A 2eph/1/1:D/1:C 2pc4/1/1:B/1:A 2pc4/1/1:D/1:C 4tr9/1/1:A/1:B