4u5f/1/1:E/1:F

Sequences
>4u5f-a1-m1-cE (length=85) [Search sequence]
GPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMI
RVVKPNSLSGAHEACKTVSCGNPCA
>4u5f-a1-m1-cF (length=85) [Search sequence]
GPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMI
RVVKPNSLSGAHEACKTVSCGNPCA
Structure information
PDB ID 4u5f (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of GluA2, con-ikot-ikot snail toxin, partial agonist KA and postitive modulator (R,R)-2b complex, GluA2cryst2 construct
Assembly ID 1
Resolution 3.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 57
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E F
UniProt accession P0CB20 P0CB20
Species 6493 (Conus striatus) 6493 (Conus striatus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4u5f-a1-m1-cE_4u5f-a1-m1-cF.pdb.gz
Full biological assembly
Download: 4u5f-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4u5b/1/1:E/1:F 4u5c/1/1:E/1:F 4u5d/1/1:E/1:F 4u5e/1/1:E/1:F 4u5h/1/1:C/1:D 4u5h/2/1:E/1:F 4u5h/3/1:H/1:G 4u5h/4/1:A/1:B

[Back to Home]