4uai/1/1:B/1:A

Sequences

>4uai-a1-m1-cB (length=67) [Search sequence]

PVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEY LEKALNK

>4uai-a1-m1-cA (length=68) [Search sequence]

KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQE YLEKALNK

Structure information

PDB ID	4uai (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of CXCL12 in complex with inhibitor
Assembly ID	1
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	68
Sequence identity between the two chains	1.0
PubMed citation	25356720

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	P48061	P48061
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:4uaiA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4uai-a1-m1-cB_4uai-a1-m1-cA.pdb.gz

Full biological assembly Download: 4uai-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1a15/1/1:B/1:A 1qg7/1/1:A/1:B 2j7z/1/1:A/1:B 2k01/1/1:A/1:C 2k03/1/1:A/1:C 2k04/1/1:A/1:C 2k05/1/1:A/1:C 2nwg/1/1:B/1:A 3gv3/1/1:A/2:A
Other dimers with similar sequences but different poses	3hp3/3/1:D/1:F 3hp3/1/1:B/1:A 3hp3/2/1:C/1:H 3hp3/4/1:E/1:G 3hp3/5/2:J/1:I