4uig/1/3:A/4:A

Sequences

>4uig-a1-m3-cA (length=91) [Search sequence]

HGYHKQKAEHLKRLRRIEGQIRGLQRMVDEDVYCIDILTQVSASTKALQSFALQLLEEHL RHCVADAALKGGTEIDAKVEEATKAIGRLLR

>4uig-a1-m4-cA (length=91) [Search sequence]

HGYHKQKAEHLKRLRRIEGQIRGLQRMVDEDVYCIDILTQVSASTKALQSFALQLLEEHL RHCVADAALKGGTEIDAKVEEATKAIGRLLR

Structure information

PDB ID	4uig (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of the copper sensitive operon repressor from Streptomyces lividans at pH6
Assembly ID	1
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	106
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	3	4
Chain ID	A	A
UniProt accession	D6EK73	D6EK73
Species	1916 (Streptomyces lividans)	1916 (Streptomyces lividans)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4uig-a1-m3-cA_4uig-a1-m4-cA.pdb.gz

Full biological assembly Download: 4uig-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	4adz/1/1:A/2:A 4adz/1/1:B/2:B 4uig/1/1:A/2:A
Other dimers with similar sequences but different poses	4adz/1/2:A/2:B 4adz/1/1:A/1:B 4uig/1/1:A/4:A 4uig/1/2:A/3:A