4uj4/3/1:C/3:L

Sequences
>4uj4-a3-m1-cC (length=36) [Search sequence]
LMEAIQKQEEINFRLQDYIDRIIVAIMETNPSILEV
>4uj4-a3-m3-cL (length=38) [Search sequence]
ELMEAIQKQEEINFRLQDYIDRIIVAIMETNPSILEVK
Structure information
PDB ID 4uj4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of human Rab11-Rabin8-FIP3
Assembly ID 3
Resolution 4.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 49
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 3
Chain ID C L
UniProt accession O75154 O75154
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4uj4-a3-m1-cC_4uj4-a3-m3-cL.pdb.gz
Full biological assembly
Download: 4uj4-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4uj4/1/1:F/1:I 4uj4/2/2:C/1:L
Other dimers with similar sequences but different poses
  • 2hv8/2/1:F/1:E 2hv8/1/1:D/2:D
  • [Back to Home]