4ur6/2/1:A/3:A

Sequences
>4ur6-a2-m1-cA (length=64) [Search sequence]
GESVVATQLIPINTALTPAMMAGKVTNPSGIPFAEMSQIVGKQVNTPVAKGQTLMPDMVK
TYVP
>4ur6-a2-m3-cA (length=64) [Search sequence]
GESVVATQLIPINTALTPAMMAGKVTNPSGIPFAEMSQIVGKQVNTPVAKGQTLMPDMVK
TYVP
Structure information
PDB ID 4ur6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the type III fish antifreeze protein from Zoarces viviparus ZvAFP6
Assembly ID 2
Resolution 1.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 37
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 3
Chain ID A A
UniProt accession R9S083 R9S083
Species 48416 (Zoarces viviparus) 48416 (Zoarces viviparus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4ur6-a2-m1-cA_4ur6-a2-m3-cA.pdb.gz
Full biological assembly
Download: 4ur6-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4ur6/1/1:B/2:B 5xqp/1/1:A/1:B 5xqp/2/1:C/2:D

[Back to Home]