4uuv/2/1:D/1:G

Sequences

>4uuv-a2-m1-cD (length=95) [Search sequence]

ALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSL RYYYEKGIMQKVAGERYVYKFVCEPDALFSMAFPD

>4uuv-a2-m1-cG (length=95) [Search sequence]

ALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSL RYYYEKGIMQKVAGERYVYKFVCEPDALFSMAFPD

Structure information

PDB ID	4uuv (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of the DNA binding ETS domain of human ETV4 in complex with DNA
Assembly ID	2
Resolution	2.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	50
Sequence identity between the two chains	1.0
PubMed citation	25866208

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	G
UniProt accession	P43268	P43268
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:4uuvD	BioLiP:4uuvG

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4uuv-a2-m1-cD_4uuv-a2-m1-cG.pdb.gz

Full biological assembly Download: 4uuv-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4avp/1/1:A/1:B 4avp/2/1:C/1:D 4co8/1/1:A/2:A 4uuv/1/1:J/1:V 4uuv/3/1:M/1:S 4uuv/4/1:A/1:P 5ils/2/1:A/2:A 5ilu/2/1:A/2:A