4uxa/9/1:K/1:L

Sequences

>4uxa-a9-m1-cK (length=131) [Search sequence]

MEIKRVGSQASGKGPADWFTGTVRIDPLFQAPDPALVAGHSTTFEPGARTAWHTHPLGQT LIVTAGCGWAQREGGAVEEIHPGDVVWFSPGEKHWHGAAPTTAMTHLAIHERLDGKAVDW MEHVTDEQYRR

>4uxa-a9-m1-cL (length=131) [Search sequence]

MEIKRVGSQASGKGPADWFTGTVRIDPLFQAPDPALVAGHSTTFEPGARTAWHTHPLGQT LIVTAGCGWAQREGGAVEEIHPGDVVWFSPGEKHWHGAAPTTAMTHLAIHERLDGKAVDW MEHVTDEQYRR

Structure information

PDB ID	4uxa (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Improved variant of (R)-selective manganese-dependent hydroxynitrile lyase from bacteria
Assembly ID	9
Resolution	2.1Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	114
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	K	L
UniProt accession	E8WYN5	E8WYN5
Species	940615 (Granulicella tundricola)	940615 (Granulicella tundricola)
Function annotation	BioLiP:4uxaK	BioLiP:4uxaL

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4uxa-a9-m1-cK_4uxa-a9-m1-cL.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 4uxa-assembly9.cif.gz

Similar dimers

Other dimers with similar sequences and structures	4bif/1/1:A/1:B 4bif/1/1:C/1:D 4bif/2/1:E/1:F 4bif/2/1:G/1:H 4uxa/10/1:I/1:J 4uxa/1/1:S/1:T 4uxa/2/1:E/1:F 4uxa/3/1:Q/1:R 4uxa/4/1:G/1:H 4uxa/5/1:O/1:P 4uxa/6/1:M/1:N 4uxa/7/1:C/1:D 4uxa/8/1:A/1:B
Other dimers with similar sequences but different poses	4bif/2/1:F/1:H 4bif/1/1:A/1:C 4bif/1/1:B/1:D 4bif/2/1:E/1:G 4bif/2/1:E/1:H 4bif/1/1:A/1:D 4bif/1/1:B/1:C 4bif/2/1:F/1:G