4wbe/2/1:C/1:B

Sequences

>4wbe-a2-m1-cC (length=119) [Search sequence]

REQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKL VDPERDMSLRLNEQYEHASIHLWDLLEGKEKPVCGTTYKVLKEIVERVFQSNYFDSTHN

>4wbe-a2-m1-cB (length=120) [Search sequence]

RREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYK LVDPERDMSLRLNEQYEHASIHLWDLLEGKEKPVCGTTYKVLKEIVERVFQSNYFDSTHN

Structure information

PDB ID	4wbe (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the HR-1 domain of human caprin-1 in the C121 space group
Assembly ID	2
Resolution	2.05Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	85
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	B
UniProt accession	Q14444	Q14444
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4wbe-a2-m1-cC_4wbe-a2-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 4wbe-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4wbe/1/1:A/2:A 4wbp/1/1:B/1:A