4whv/2/1:I/1:J

Sequences
>4whv-a2-m1-cI (length=101) [Search sequence]
EKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPI
CRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERK
>4whv-a2-m1-cJ (length=101) [Search sequence]
EKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPI
CRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERK
Structure information
PDB ID 4whv (database links: RCSB PDB PDBe PDBj PDBsum)
Title E3 ubiquitin-protein ligase RNF8 in complex with Ubiquitin-conjugating enzyme E2 N and Polyubiquitin-B
Assembly ID 2
Resolution 8.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 82
Sequence identity between the two chains 1.0
PubMed citation 26903517
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID I J
UniProt accession O76064 O76064
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:4whvI BioLiP:4whvJ
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4whv-a2-m1-cI_4whv-a2-m1-cJ.pdb.gz
Full biological assembly
Download: 4whv-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4ayc/1/1:B/1:A 4ayc/1/2:B/2:A 4orh/1/1:K/1:L 4orh/2/1:G/1:H 4whv/1/1:C/1:D
Other dimers with similar sequences but different poses
  • 4ayc/1/2:B/1:A 4ayc/1/1:B/2:A
  • [Back to Home]