4wk1/1/2:A/3:A

Sequences
>4wk1-a1-m2-cA (length=92) [Search sequence]
GLVPRGSHMKMIIAIVQDQDSQELADQLVKNNFRATKLATTGGFLRAGNTTFLCGVNDDR
VDEILSVINQTCGNEVGGATVFVMPVDAFHQF
>4wk1-a1-m3-cA (length=92) [Search sequence]
GLVPRGSHMKMIIAIVQDQDSQELADQLVKNNFRATKLATTGGFLRAGNTTFLCGVNDDR
VDEILSVINQTCGNEVGGATVFVMPVDAFHQF
Structure information
PDB ID 4wk1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Staphylococcus aureus PstA in complex with c-di-AMP
Assembly ID 1
Resolution 1.98Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 67
Sequence identity between the two chains 1.0
PubMed citation 25435171
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID A A
UniProt accession A0A0H2WXZ7 A0A0H2WXZ7
Species 93062 (Staphylococcus aureus subsp. aureus COL) 93062 (Staphylococcus aureus subsp. aureus COL)
Function annotation BioLiP:4wk1A BioLiP:4wk1A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4wk1-a1-m2-cA_4wk1-a1-m3-cA.pdb.gz
Full biological assembly
Download: 4wk1-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4d3g/1/1:A/2:A 4d3g/1/1:A/3:A 4d3g/1/2:A/3:A 4wk1/1/1:A/2:A 4wk1/1/1:A/3:A 4wk3/1/1:A/2:A 4wk3/1/1:A/3:A 4wk3/1/2:A/3:A

[Back to Home]