4wkb/1/1:A/1:B

Sequences

>4wkb-a1-m1-cA (length=237) [Search sequence]

MKIGIIGAMQQEVAILKDLIEDVQEVNQAGCTFYSGQIQGVDVVLLQSGIGKVSAALGTA
LLISQYAPDVVINTGSAGGFDASLNVGDVVISSEVRHHDADVTAFGYEIGQMAGQPAAFK
ADEKLMTVAEQALAQLPNTHAVRGLICTGDAFVCTAERQQFIRQHFPSVVAVEMEASAIA
QTCHQFKVPFVVVRAISDVADKESPLSFEEFLPLAAKSSSAMVLKMVELLKENLYFQ

>4wkb-a1-m1-cB (length=237) [Search sequence]

Structure information

PDB ID	4wkb (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Vibrio cholerae 5'-methylthioadenosine/S-adenosyl homocysteine nucleosidase (MTAN) complexed with methylthio-DADMe-Immucillin-A
Assembly ID	1
Resolution	1.37Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	129
Sequence identity between the two chains	1.0
PubMed citation	25806409

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	A5F5R2	A5F5R2
Species	345073 (Vibrio cholerae O395)	345073 (Vibrio cholerae O395)
Function annotation	BioLiP:4wkbA	BioLiP:4wkbB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	4wkb-a1-m1-cA_4wkb-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	4wkb-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3dp9/1/1:A/1:C 4x24/1/1:A/1:B